Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK4
LigandBDBM50208628
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1633069
IC50 21±n/a nM
Citation Labrière CLozach OBlairvacq MMeijer LGuillou C Further investigation of Paprotrain: Towards the conception of selective and multi-targeted CNS kinase inhibitors. Eur J Med Chem 124:920-934 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK4
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 4 | CLK4
Type:Serine/threonine-protein kinase
Mol. Mass.:57522.53
Organism:Homo sapiens (Human)
Description:gi_10190706
Residue:481
Sequence:
MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKK
K
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208628
n/a
NameBDBM50208628
Synonyms:CHEMBL3885036
TypeSmall organic molecule
Emp. Form.C18H12N4O2
Mol. Mass.316.3135
SMILESCOc1ccc2[nH]c3c(c(C#N)c([nH]c3=O)-c3cccnc3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: