Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRedox-regulatory protein FAM213A
LigandBDBM50357312
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1634422
IC50 900±n/a nM
Citation Munoz L Non-kinase targets of protein kinase inhibitors. Nat Rev Drug Discov 16:424-440 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Redox-regulatory protein FAM213A
Name:Redox-regulatory protein FAM213A
Synonyms:C10orf58 | FAM213A | PAMM | Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes | Protein PAMM | Redox-regulatory protein FAM213A
Type:PROTEIN
Mol. Mass.:25768.88
Organism:Homo sapiens (Human)
Description:ChEMBL_116949
Residue:229
Sequence:
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357312
n/a
NameBDBM50357312
Synonyms:IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compound 1 | US9108973, Ref 1 | US9181263, 1 | US9278100, 1
TypeSmall organic molecule
Emp. Form.C25H24N6O2
Mol. Mass.440.4971
SMILESNc1ncnc2n(nc(-c3ccc(Oc4ccccc4)cc3)c12)[C@@H]1CCCN(C1)C(=O)C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: