| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peroxiredoxin-like 2A |
|---|
| Ligand | BDBM50357312 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1634422 (CHEMBL3877214) |
|---|
| IC50 | 900±n/a nM |
|---|
| Citation |  Munoz, L Non-kinase targets of protein kinase inhibitors. Nat Rev Drug Discov16:424-440 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peroxiredoxin-like 2A |
|---|
| Name: | Peroxiredoxin-like 2A |
|---|
| Synonyms: | C10orf58 | FAM213A | PAMM | PRXL2A | PXL2A_HUMAN | Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes | Protein PAMM | Redox-regulatory protein FAM213A |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25768.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_116949 |
|---|
| Residue: | 229 |
|---|
| Sequence: | MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
|
|
|
|---|
| BDBM50357312 |
|---|
| n/a |
|---|
| Name | BDBM50357312 |
|---|
| Synonyms: | IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compound 1 | US10711006, Compound Ibrutinib | US10793575, Example ibrutinib | US10835536, Ref. Ex. Comp 1 | US10919899, Ibrutinib | US11078206, Example Ibrutinib | US11186578, Example Ibrutinib | US11339167, Example Ibrutinib | US11407754, Example Ibrutinib | US20230364079, Example Ibrutinib | US9108973, Ref 1 | US9181263, 1 | US9278100, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H24N6O2 |
|---|
| Mol. Mass. | 440.4971 |
|---|
| SMILES | Nc1ncnc2n(nc(-c3ccc(Oc4ccccc4)cc3)c12)[C@@H]1CCCN(C1)C(=O)C=C |
|---|
| Structure | 
|
|---|
Search and Browse
