Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50378584
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1634987
Ki 30±n/a nM
Citation Madapa SGadhiya SKurtzman TAlberts ILRamsey SReith MHarding WW Synthesis and evaluation of C9 alkoxy analogues of (-)-stepholidine as dopamine receptor ligands. Eur J Med Chem 125:255-268 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50378584
n/a
NameBDBM50378584
Synonyms:STEPHOLIDINE
TypeSmall organic molecule
Emp. Form.C19H21NO4
Mol. Mass.327.3743
SMILESCOc1cc2CCN3Cc4c(C[C@H]3c2cc1O)ccc(O)c4OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: