Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50210860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1635026
Ki 0.250000±n/a nM
Citation Cacheux FMÚdran-Navarrete VDollÚ FMarguet FPuech FDamont A Synthesis and inávitro characterization of novel fluorinated derivatives of the translocator protein 18ákDa ligand CfO-DPA-714. Eur J Med Chem 125:346-359 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210860
n/a
NameBDBM50210860
Synonyms:CHEMBL3936390
TypeSmall organic molecule
Emp. Form.C23H29FN4O
Mol. Mass.396.501
SMILESCCCN(C)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(CCCF)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: