Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranslocator protein
LigandBDBM50159089
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1635860
Ki 2.7±n/a nM
Citation Kim TYang HYPark BGJung SYPark JHPark KDMin SJTae JYang HCho SCho SJSong HMook-Jung ILee JPae AN Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease. Eur J Med Chem 125:1172-1192 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Translocator protein
Name:Translocator protein
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor
Type:Enzyme
Mol. Mass.:18834.74
Organism:Homo sapiens (Human)
Description:P30536
Residue:169
Sequence:
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159089
n/a
NameBDBM50159089
Synonyms:CHEMBL180523 | N,N-Dibutyl-2-[6,8-dichloro-2-(4-chloro-phenyl)-imidazo[1,2-a]pyridin-3-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C23H26Cl3N3O
Mol. Mass.466.831
SMILESCCCCN(CCCC)C(=O)Cc1c(nc2c(Cl)cc(Cl)cn12)-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: