| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50185957 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1635860 |
|---|
| IC50 | 0.920000±n/a nM |
|---|
| Citation |  Kim T; Yang HY; Park BG; Jung SY; Park JH; Park KD; Min SJ; Tae J; Yang H; Cho S; Cho SJ; Song H; Mook-Jung I; Lee J; Pae AN Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease. Eur J Med Chem 125:1172-1192 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50185957 |
|---|
| n/a |
|---|
| Name | BDBM50185957 |
|---|
| Synonyms: | CHEMBL205767 | N-(2-isopropoxybenzyl)-N-(4-chloro-2-phenoxyphenyl)acetamide | N-(4-chloro-2-phenoxyphenyl)-N-(2-isopropoxybenzyl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24ClNO3 |
|---|
| Mol. Mass. | 409.905 |
|---|
| SMILES | CC(C)Oc1ccccc1CN(C(C)=O)c1ccc(Cl)cc1Oc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
