Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBCR/ABL p210 fusion protein
LigandBDBM50211223
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1636131
EC50<100±n/a nM
Citation Wang QLiu FWang BZou FQi ZChen CYu KHu CQi SWang WHu ZLiu JWang WWang LLiang QZhang SRen TLiu QLiu J Discovery of 4-Methyl-N-(4-((4-methylpiperazin-1-yl)methyl)-3-(trifluoromethyl)phenyl)-3-((1-nicotinoylpiperidin-4-yl)oxy)benzamide (CHMFL-ABL/KIT-155) as a Novel Highly Potent Type II ABL/KIT Dual Kinase Inhibitor with a Distinct Hinge Binding. J Med Chem 60:273-289 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BCR/ABL p210 fusion protein
Name:BCR/ABL p210 fusion protein
Synonyms:BCR/ABL | BCR/ABL p210 fusion protein | fusion
Type:PROTEIN
Mol. Mass.:10728.88
Organism:Homo sapiens (Human)
Description:ChEMBL_102433
Residue:97
Sequence:
QMLTNSCVKLQTVHSIPLTINKEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDP
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211223
n/a
NameBDBM50211223
Synonyms:CHEMBL3939150
TypeSmall organic molecule
Emp. Form.C33H38F3N5O3
Mol. Mass.609.6817
SMILESCN1CCN(Cc2ccc(cc2C(F)(F)F)C(=O)Nc2ccc(C)c(OC3CCN(CC3)C(=O)c3ccc(C)nc3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: