| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoacylglycerol lipase ABHD6 |
|---|
| Ligand | BDBM50211236 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1636269 |
|---|
| IC50 | 40±n/a nM |
|---|
| Citation |  Deng, H; Kooijman, S; van den Nieuwendijk, AM; Ogasawara, D; van der Wel, T; van Dalen, F; Baggelaar, MP; Janssen, FJ; van den Berg, RJ; den Dulk, H; Cravatt, BF; Overkleeft, HS; Rensen, PC; van der Stelt, M Triazole Ureas Act as Diacylglycerol Lipase Inhibitors and Prevent Fasting-Induced Refeeding. J Med Chem60:428-440 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoacylglycerol lipase ABHD6 |
|---|
| Name: | Monoacylglycerol lipase ABHD6 |
|---|
| Synonyms: | 2-arachidonoylglycerol hydrolase | ABHD6 | ABHD6_HUMAN | Abhydrolase domain-containing protein 6 | Monoacylglycerol lipase ABHD6 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38341.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105457 |
|---|
| Residue: | 337 |
|---|
| Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
|
|
|
|---|
| BDBM50211236 |
|---|
| n/a |
|---|
| Name | BDBM50211236 |
|---|
| Synonyms: | CHEMBL2144065 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H26N4O |
|---|
| Mol. Mass. | 422.5215 |
|---|
| SMILES | O=C(N1CCCCC1Cc1ccccc1)n1cc(nn1)-c1ccc(cc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
