new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor
LigandBDBM50013889
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98507
Ki 0.120000±n/a nM
Citation  TBA Bioorg Med Chem Lett 3:1985-1990 (1993)  
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor
Name:Leukotriene B4 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 88360
Components:This complex has 2 components.
Component 1
Name:Leukotriene B4 receptor
Synonyms:LTB4 receptor JULF2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2
Type:Enzyme Catalytic Domain
Mol. Mass.:41553.59
Organism:Homo sapiens (Human)
Description:Leukotriene 2 0 HUMAN::Q9NPC1
Residue:389
Sequence:
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013889
n/a
NameBDBM50013889
Synonyms:(5S,6Z,8E,10E,12R,14Z)-5,12-dihydroxyicosa-6,8,10,14-tetraenoic acid | (S-(R*,S*-(E,Z,E,Z)))-5,12-Dihydroxy-6,8,10,14-eicosatetraenoic acid | 5,12-Dihete | 5,12-Hete | 5S,12R-dihydroxy-6Z,8E,10E,14Z-eicosatetraenoic acid | CHEMBL65061 | DIHETE 12(s), 5(s) | LTB4 | leukotriene B4
TypeSmall organic molecule
Emp. Form.C20H32O4
Mol. Mass.336.4657
SMILESCCCCC\C=C/C[C@@H](O)\C=C\C=C\C=C/[C@@H](O)CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: