new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
LigandBDBM50005835
Substrate/Competitorn/a
Meas. Tech.ChEBML_2582
IC50>10000±n/a nM
Citation  TBA Bioorg Med Chem Lett 6:1825-1830 (1996)  
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:5-HT-2 | 5-HT-2A | 5-HT-S1A | 5-HT-S2 | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2A | Serotonin Receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52852.05
Organism:Rattus norvegicus (rat)
Description:Rat cortex membranes 5-HT2A receptors.
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005835
n/a
NameBDBM50005835
Synonyms:(3-[2-(dimethylamino)ethyl]-1H-indol-5-yl)-N-methylmethanesulfonamide | 1-[3-(2-dimethylaminoethyl)-1H-indol-5-yl]-N-methyl-methanesulfonamide | 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide | 3-(2-(dimethylamino)ethyl)-N-methyl-1H-indole-5-methanesulfonamide | 3-[2-(dimethylamino)ethyl]-N-methylindole-5-methanesulfonamide | CHEMBL128 | SUMATRIPTAN | Sumatran | Sumax
TypeSmall organic molecule
Emp. Form.C14H21N3O2S
Mol. Mass.295.4
SMILESCNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: