new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50033437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1954
IC50 16±n/a nM
Citation  TBA Bioorg Med Chem Lett 6:1825-1830 (1996)  
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033437
n/a
NameBDBM50033437
Synonyms:CHEMBL905 | MK 462 free base | N,N-dimethyl-2-[5-(1,2,4-triazol-1-ylmethyl)-1H-indol-3-yl]-ethanamine | N,N-dimethyl-2-[5-(1H-1,2,4-triazol-1-ylmethyl)-1H-indol-3-yl]ethanamine | N,N-dimethyl-5-(1H-1,2,4-triazol-1-ylmethyl)-1H-indole-3-ethanamine | RIZATRIPTAN | risatriptan
TypeSmall organic molecule
Emp. Form.C15H19N5
Mol. Mass.269.3449
SMILESCN(C)CCc1c[nH]c2ccc(Cn3cncn3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: