Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM24567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_152476
IC50 806±n/a nM
Citation Dollinger LMHowell AR A 2-methyleneoxetane analog of orlistat demonstrating inhibition of porcine pancreatic lipase. Bioorg Med Chem Lett 8:977-8 (1998) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic lipase
Synonyms:PL
Type:PROTEIN
Mol. Mass.:51157.75
Organism:Homo sapiens (Human)
Description:ChEMBL_527250
Residue:465
Sequence:
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24567
n/a
NameBDBM24567
Synonyms:(2S)-1-[(2S,3S)-3-hexyl-4-oxooxetan-2-yl]tridecan-2-yl (2S)-2-formamido-4-methylpentanoate | CHEMBL175247 | Orlistat | THLP | Tetrahydrolipstatin | US9328123, Orlistat | Xenical
TypeSmall organic molecule
Emp. Form.C29H53NO5
Mol. Mass.495.7348
SMILESCCCCCCCCCCC[C@@H](C[C@@H]1OC(=O)[C@H]1CCCCCC)OC(=O)[C@H](CC(C)C)NC=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: