Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMecA PBP2' (penicillin binding protein 2')
LigandBDBM50217404
Substrate/Competitorn/a
Meas. Tech.ChEBML_153664
IC50 1.4±n/a nM
Citation Wilkening RRRatcliffe RWWildonger KJCama LDDykstra KDDiNinno FPBlizzard TAHammond MLHeck JVDorso KLSt Rose EKohler JHammond GG Synthesis and activity of 2-(sulfonamido)methyl-carbapenems: discovery of a novel, anti-MRSA 1,8-naphthosultam pharmacophore. Bioorg Med Chem Lett 9:673-8 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MecA PBP2' (penicillin binding protein 2')
Name:Penicillin-binding protein
Synonyms:MecA PBP2'' (penicillin binding protein 2'') | PBP2A | mecA
Type:PROTEIN
Mol. Mass.:76283.66
Organism:Staphylococcus aureus
Description:ChEMBL_105733
Residue:668
Sequence:
MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEV
EMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKED
GMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTHMRLGIVPKNVSK
KDYKAIAKELSISEDYINNKWIKIGYKMIPSFHFKTVKKMDEYLSDFAKKFHLTTNETES
RNYPLEKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVT
IVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLAL
VSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLD
DKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFE
KGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALEN
NGNINAPHLLKDTKNKVWKKNIISKENINLLNDGMQQVVNKTHKEDIYRSYANLIGKSGT
AELKMKQGESGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENG
NKKYDIDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50217404
n/a
NameBDBM50217404
Synonyms:CHEMBL348278
TypeSmall organic molecule
Emp. Form.C23H19N2NaO6
Mol. Mass.442.3965
SMILES[Na+].[H][C@]12[C@@H](C)C(CN3C(=O)c4cccc5cccc(C3=O)c45)=C(N1C(=O)[C@]2([H])[C@@H](C)O)C([O-])=O |c:23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: