Reaction Details |
| Report a problem with these data |
Target | Tryptase delta |
---|
Ligand | BDBM50217818 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_210701 (CHEMBL817298) |
---|
IC50 | <1.7±n/a nM |
---|
Citation | Slusarchyk, WA; Bolton, SA; Hartl, KS; Huang, MH; Jacobs, G; Meng, W; Ogletree, ML; Pi, Z; Schumacher, WA; Seiler, SM; Sutton, JC; Treuner, U; Zahler, R; Zhao, G; Bisacchi, GS Synthesis of potent and highly selective inhibitors of human tryptase. Bioorg Med Chem Lett12:3235-8 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase delta |
---|
Name: | Tryptase delta |
Synonyms: | Delta-tryptase | HmMCP-3-like tryptase III | Mast cell mMCP-7-like | TPSD1 | TRYD_HUMAN | Tryptase delta | Tryptase-3 |
Type: | PROTEIN |
Mol. Mass.: | 26578.73 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_104777 |
Residue: | 242 |
Sequence: | MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGP
YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF
YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPY
PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVN
GT
|
|
|
BDBM50217818 |
---|
n/a |
---|
Name | BDBM50217818 |
Synonyms: | CHEMBL440515 |
Type | Small organic molecule |
Emp. Form. | C28H40N6O5 |
Mol. Mass. | 540.6544 |
SMILES | NC(=N)N1CCCC(C[C@@H]2[C@H](N(C(=O)N3CCN(CC3)C(=O)CCCCCc3ccccc3)C2=O)C(O)=O)C1 |
Structure |
|