Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoleucyl-tRNA synthetase
LigandBDBM50217847
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88825
IC50<1000±n/a nM
Citation Shimizu TUsui TMachida KFuruya KOsada HNakata T Chemical modification of reveromycin A and its biological activities. Bioorg Med Chem Lett 12:3363-6 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Isoleucyl-tRNA synthetase
Name:Isoleucyl-tRNA synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:5742.00
Organism:Rattus norvegicus
Description:ChEMBL_88824
Residue:50
Sequence:
MQTSLGNFVTTTGISSTRTPRPRRESVYFDLIKLKIFHQITQENPGSRNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50217847
n/a
NameBDBM50217847
Synonyms:CHEMBL114741
TypeSmall organic molecule
Emp. Form.C32H48O8
Mol. Mass.560.7187
SMILES[H][C@]1(C\C=C(/C)\C=C\[C@H](O)[C@@H](C)\C=C\C(O)=O)O[C@@]2(CC[C@@](CCCC)(O2)[C@@H](O)\C=C\C(\C)=C\C(O)=O)CC[C@@H]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: