Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor alpha
LigandBDBM50160161
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34616
Ki 32±n/a nM
Citation Lopez FJArias LChan RClarke DEElworthy TRFord APGuzman AJaime-Figueroa SJasper JRMorgans DJPadilla FPerez-Medrano AQuintero CRomero MSandoval LSmith SAWilliams TJBlue DR Synthesis, pharmacology and pharmacokinetics of 3-(4-aryl-piperazin-1-ylalkyl)-uracils as uroselective alpha1A-antagonists. Bioorg Med Chem Lett 13:1873-8 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor alpha
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160161
n/a
NameBDBM50160161
Synonyms:5-Methyl-3-(3-{4-[2-(2,2,2-trifluoro-ethoxy)-phenyl]-piperazin-1-yl}-propyl)-1H-pyrimidine-2,4-dione | CHEMBL56331 | RS-100329
TypeSmall organic molecule
Emp. Form.C20H25F3N4O3
Mol. Mass.426.4327
SMILESCc1c[nH]c(=O)n(CCCN2CCN(CC2)c2ccccc2OCC(F)(F)F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: