Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405076 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54925 (CHEMBL857514) |
---|
Ki | 4.4±n/a nM |
---|
Citation | Coats, EA; Genther, CS; Dietrich, SW; Guo, ZR; Hansch, C Comparison of the inhibition of methotrexate-sensitive and -resistant Lactobacillus casei cell cultures with purified Lactobacillus casei dihydrofolate reductase by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(3-substituted-phenyl)-s-triazines. Use of quantitative structure-activity relationships in maki J Med Chem24:1422-9 (1981) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50405076 |
---|
n/a |
---|
Name | BDBM50405076 |
Synonyms: | CHEMBL269704 |
Type | Small organic molecule |
Emp. Form. | C18H19Cl2N5O |
Mol. Mass. | 392.282 |
SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(OCc2ccc(Cl)c(Cl)c2)c1 |t:3,6| |
Structure |
|