| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50291789 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54925 (CHEMBL857514) |
|---|
| Ki | 5.4±n/a nM |
|---|
| Citation |  Coats, EA; Genther, CS; Dietrich, SW; Guo, ZR; Hansch, C Comparison of the inhibition of methotrexate-sensitive and -resistant Lactobacillus casei cell cultures with purified Lactobacillus casei dihydrofolate reductase by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(3-substituted-phenyl)-s-triazines. Use of quantitative structure-activity relationships in maki J Med Chem24:1422-9 (1981) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50291789 |
|---|
| n/a |
|---|
| Name | BDBM50291789 |
|---|
| Synonyms: | 1-[3-(3-Chloro-phenoxymethyl)-phenyl]-6,6-dimethyl-1,6-dihydro-[1,3,5]triazine-2,4-diamine | CHEMBL417461 | xv1-[3-(3-Chloro-phenoxymethyl)-phenyl]-6,6-dimethyl-1,6-dihydro-[1,3,5]triazine-2,4-diamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H20ClN5O |
|---|
| Mol. Mass. | 357.837 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(COc2cccc(Cl)c2)c1 |t:3,6| |
|---|
| Structure | 
|
|---|
Search and Browse
