Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50138691
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54732
Ki 19±n/a nM
Citation Hansch CLi RBlaney JMLangridge R Comparison of the inhibition of Escherichia coli and Lactobacillus casei dihydrofolate reductase by 2,4-diamino-5-(substituted-benzyl)pyrimidines: quantitative structure-activity relationships, X-ray crystallography, and computer graphics in structure-activity analysis. J Med Chem 25:777-84 (1982) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:Dihydrofolate reductase (F31V) | dfrA17
Type:n/a
Mol. Mass.:17532.46
Organism:Escherichia coli
Description:n/a
Residue:157
Sequence:
MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138691
n/a
NameBDBM50138691
Synonyms:5-(3,4-Dimethoxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL19633 | Diaveridine
TypeSmall organic molecule
Emp. Form.C13H16N4O2
Mol. Mass.260.2917
SMILESCOc1ccc(Cc2cnc(N)nc2N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: