| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50405977 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54732 (CHEMBL668772) |
|---|
| Ki | 20±n/a nM |
|---|
| Citation |  Hansch, C; Li, R; Blaney, JM; Langridge, R Comparison of the inhibition of Escherichia coli and Lactobacillus casei dihydrofolate reductase by 2,4-diamino-5-(substituted-benzyl)pyrimidines: quantitative structure-activity relationships, X-ray crystallography, and computer graphics in structure-activity analysis. J Med Chem25:777-84 (1982) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50405977 |
|---|
| n/a |
|---|
| Name | BDBM50405977 |
|---|
| Synonyms: | CHEMBL277391 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13F3N4O |
|---|
| Mol. Mass. | 298.2637 |
|---|
| SMILES | COc1ccc(Cc2cnc(N)nc2N)cc1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
