| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase type 1 |
|---|
| Ligand | BDBM50291795 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54572 (CHEMBL664886) |
|---|
| Ki | 646±n/a nM |
|---|
| Citation |  Coats, EA; Genther, CS; Selassie, CD; Strong, CD; Hansch, C Quantitative structure-activity relationship of antifolate inhibition of bacteria cell cultures resistant and sensitive to methotrexate. J Med Chem28:1910-6 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase type 1 |
|---|
| Name: | Dihydrofolate reductase type 1 |
|---|
| Synonyms: | DYR1_ECOLX | dhfrI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17574.87 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_54248 |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
|
|
|
|---|
| BDBM50291795 |
|---|
| n/a |
|---|
| Name | BDBM50291795 |
|---|
| Synonyms: | CHEMBL441503 | {3-[3-(4,6-Diamino-2,2-dimethyl-2H-[1,3,5]triazin-1-yl)-benzyloxy]-phenyl}-methanol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N5O2 |
|---|
| Mol. Mass. | 353.4182 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(COc2cccc(CO)c2)c1 |t:3,6| |
|---|
| Structure | 
|
|---|
Search and Browse
