Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50226401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158072
Ki 35000±n/a nM
Citation Digenis GAAgha BJTsuji KKato MShinogi M Peptidyl carbamates incorporating amino acid isosteres as novel elastase inhibitors. J Med Chem 29:1468-76 (1986) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 152345
Components:This complex has 2 components.
Component 1
Name:Pancreatic elastase
Synonyms:Elastase 1 | Elastase-1 | Pancreatic elastase
Type:Enzyme
Mol. Mass.:28827.71
Organism:Sus scrofa (Pig)
Description:P00772
Residue:266
Sequence:
MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTL
IRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDI
ALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVD
YAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGC
NVTRKPTVFTRVSAYISWINNVIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50226401
n/a
NameBDBM50226401
Synonyms:CHEMBL3143927
TypeSmall organic molecule
Emp. Form.C27H33F5N4O8
Mol. Mass.636.5649
SMILESCOC(=O)CCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)CN(C(C)C)C(=O)Oc1c(F)c(F)c(F)c(F)c1F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: