Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50007664
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49422
IC50 100000±n/a nM
Citation Bock MGDiPardo RMEvans BERittle KEFreidinger RMChang RSLotti VJ Cholecystokinin antagonists. Synthesis and biological evaluation of 3-substituted 1,4-benzodiazepin-2-amines. J Med Chem 31:264-8 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 357790
Components:This complex has 2 components.
Component 1
Name:Cholecystokinin receptor
Synonyms:CCK-A receptor | CCK-AR | CCK1-R | Cholecystokinin receptor type A | Cholecystokinin-1 Receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47859.34
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-1 receptors in HEK 293 cells.
Residue:428
Sequence:
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cholecystokinin receptor
Synonyms:CCK-2 receptor | CCK-B receptor | CCK-BR | CCKBR | Cholecystokinin A | Cholecystokinin-2 Receptor | Gastrin/cholecystokinin type B receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48445.79
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-2 receptors in HEK 293 cells.
Residue:447
Sequence:
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007664
n/a
NameBDBM50007664
Synonyms:7-chloro-2-methylamino-5-phenyl-3H-1,4-benzodiazepin-4-oxide | 7-chloro-N-methyl-5-phenyl-3H-1,4-benzodiazepin-2-amine 4-oxide | CDP | CHEMBL451 | CHLORDIAZEPOXIDE | clopoxide | methaminodiazepoxide
TypeSmall organic molecule
Emp. Form.C16H14ClN3O
Mol. Mass.299.755
SMILESCNC1=Nc2ccc(Cl)cc2C(c2ccccc2)=[N+]([O-])C1 |t:2,19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: