| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50029760 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54731 |
|---|
| Ki | 4.5±n/a nM |
|---|
| Citation |  Li, RL; Poe, M Quantitative structure-activity relationships for the inhibition of Escherichia coli dihydrofolate reductase by 5-(substituted benzyl)-2,4-diaminopyrimidines. J Med Chem31:366-70 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50029760 |
|---|
| n/a |
|---|
| Name | BDBM50029760 |
|---|
| Synonyms: | 5-[3,5-Dimethoxy-4-(2-methoxy-ethoxy)-benzyl]-pyrimidine-2,4-diamine | 5-[3,5-Dimethoxy-4-(2-methoxy-ethoxy)-benzyl]-pyrimidine-2,4-diamine(Tetroxoprim ) | CHEMBL32039 | Tetroxoprim |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H22N4O4 |
|---|
| Mol. Mass. | 334.3703 |
|---|
| SMILES | COCCOc1c(OC)cc(Cc2cnc(N)nc2N)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
