Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase A |
---|
Ligand | BDBM50230210 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1644714 (CHEMBL3993643) |
---|
Kd | 25±n/a nM |
---|
Citation | Steadman, VA; Pettit, SB; Poullennec, KG; Lazarides, L; Keats, AJ; Dean, DK; Stanway, SJ; Austin, CA; Sanvoisin, JA; Watt, GM; Fliri, HG; Liclican, AC; Jin, D; Wong, MH; Leavitt, SA; Lee, YJ; Tian, Y; Frey, CR; Appleby, TC; Schmitz, U; Jansa, P; Mackman, RL; Schultz, BE Discovery of Potent Cyclophilin Inhibitors Based on the Structural Simplification of Sanglifehrin A. J Med Chem60:1000-1017 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase A |
Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
Type: | Protein |
Mol. Mass.: | 18015.32 |
Organism: | Homo sapiens (Human) |
Description: | P62937 |
Residue: | 165 |
Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
BDBM50230210 |
---|
n/a |
---|
Name | BDBM50230210 |
Synonyms: | CHEMBL4090107 |
Type | Small organic molecule |
Emp. Form. | C34H50N4O8 |
Mol. Mass. | 642.7828 |
SMILES | CO[C@H]1\C=C\C=C\CCOC(=O)[C@@H]2CCCN(N2)C(=O)[C@H](Cc2cccc(O)c2)NC(=O)[C@@H](NC(=O)[C@H](C)[C@H](OC)[C@H]1C)C(C)C |r,t:3,5| |
Structure |
|