Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon-like peptide 1 receptor
LigandBDBM50231947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1645788
Ki 1.4±n/a nM
Citation Plisson FHill TAMitchell JMHoang HNde Araujo ADXu WCotterell AEdmonds DJStanton RVDerksen DRLoria PMGriffith DAPrice DALiras SFairlie DP Helixconstraints and amino acid substitution in GLP-1 increase cAMP and insulin secretion but not beta-arrestin 2 signaling. Eur J Med Chem 127:703-714 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Glucagon-like peptide 1 receptor
Name:Glucagon-like peptide 1 receptor
Synonyms:GLP-1 receptor | GLP-1-R | GLP-1R | Glucagon-like peptide 1 receptor
Type:Enzyme
Mol. Mass.:53035.78
Organism:Homo sapiens (Human)
Description:P43220
Residue:463
Sequence:
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50231947
n/a
NameBDBM50231947
Synonyms:CHEMBL4062134
TypeSmall organic molecule
Emp. Form.C151H222N42O48
Mol. Mass.3393.631
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N1)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: