Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPARP 1, 2 and 3
LigandBDBM27497
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1646304
IC50 34±n/a nM
Citation Thorsell AGEkblad TKarlberg TLöw MPinto AFTrésaugues LMoche MCohen MSSchüler H Structural Basis for Potency and Promiscuity in Poly(ADP-ribose) Polymerase (PARP) and Tankyrase Inhibitors. J Med Chem 60:1262-1271 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
PARP 1, 2 and 3
Name:PARP 1, 2 and 3
Synonyms:(ARTD2 or PARP2) | Poly [ADP-ribose] polymerase 2 | Poly [ADP-ribose] polymerase 2 (PARP-2) | Poly [ADP-ribose] polymerase 2 (PARP2) | Poly [ADP-ribose] polymerase 3 (PARP3)
Type:Enyme
Mol. Mass.:66225.70
Organism:Homo sapiens (Human)
Description:Q9UGN5
Residue:583
Sequence:
MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKD
RTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLN
QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKF
LDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQE
LIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALME
ACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQ
HYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLK
NTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGP
ASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27497
n/a
NameBDBM27497
Synonyms:2-(dimethylamino)-N-(6-oxo-5,6-dihydrophenanthridin-2-yl)acetamide | 2-Dimethylamino-N-(6-oxo-5,6-dihydro-phenanthridin-2-yl)-acetamide | CHEMBL372303 | N-(6-oxo-5,6-dihydro- phenanthridin-2-yl)-N,N-dimethylacetamide | N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE | PJ34
TypeSmall organic molecule
Emp. Form.C17H17N3O2
Mol. Mass.295.3358
SMILESCN(C)CC(=O)Nc1ccc2[nH]c(=O)c3ccccc3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: