Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM50232349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1646376
IC50 3200±n/a nM
Citation Kang HSKim JP Ostalactones A-C,- ande-Lactones with Lipase Inhibitory Activity from the Cultured Basidiomycete Stereum ostrea. J Nat Prod 79:3148-3151 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic lipase
Synonyms:PL
Type:PROTEIN
Mol. Mass.:51157.75
Organism:Homo sapiens (Human)
Description:ChEMBL_527250
Residue:465
Sequence:
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50232349
n/a
NameBDBM50232349
Synonyms:CHEMBL4102155
TypeSmall organic molecule
Emp. Form.C14H20O4
Mol. Mass.252.3062
SMILES[H][C@]12[#6]-[#6](=[#6][C@@]1([#6]\[#6]=[#6](\[#6])-[#6])[#6](=O)-[#8]2)-[#6](-[#8]-[#6])-[#8]-[#6] |r,c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: