Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E receptor 4
LigandBDBM50107283
Substrate/Competitorn/a
Meas. Tech.ChEBML_1648046
Ki 24±n/a nM
Citation Okumura YYamagishi TNukui SNakao K Discovery of AAT-008, a novel, potent, and selective prostaglandin EP4 receptor antagonist. Bioorg Med Chem Lett 27:1186-1192 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E receptor 4
Name:Prostaglandin E receptor 4
Synonyms:PTGER4 | Prostaglandin E receptor 4 | Prostaglandin E2 receptor EP4 subtype
Type:PROTEIN
Mol. Mass.:53444.07
Organism:Canis lupus familiaris
Description:ChEMBL_117515
Residue:492
Sequence:
MSTPGANASASSTPDRPNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGEALCEYSTFILLFFSLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLVAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHPAAGALAVPSAL
CRSHPAAAAPSPALPRLSDFRRRRSFRGIAGAEIQMVILLIATSLVVLICSIPLVVRVFI
NQLYQPRLVKEISKNPDLQAIRIAAVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGS
RRDRSGQHCSESRRTSSAMSGHSRSFLSRELKETSSTSQTLLYMPDLSENGLGGRNLLPG
VPGMGLPQADTTSLRTLRISETSDSSQGQDSESVLLVDEVGGSSHQSGPGPKGNSLQVTF
PNETLNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107283
n/a
NameBDBM50107283
Synonyms:AAT-007 | CJ-023 | GRAPIPRANT | Grapiprant | MR-10A7 | RQ-00000007 | RQ-7
TypeSmall organic molecule
Emp. Form.C26H29N5O3S
Mol. Mass.491.605
SMILESCCc1nc2c(C)nc(C)cc2n1-c1ccc(CCNC(=O)NS(=O)(=O)c2ccc(C)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: