Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysyl oxidase homolog 2
LigandBDBM10758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1648485
IC50 60100±n/a nM
Citation Hutchinson JHRowbottom MWLonergan DDarlington JProdanovich PKing CDEvans JFBain G Small Molecule Lysyl Oxidase-like 2 (LOXL2) Inhibitors: The Identification of an Inhibitor Selective for LOXL2 over LOX. ACS Med Chem Lett 8:423-427 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysyl oxidase homolog 2
Name:Lysyl oxidase homolog 2
Synonyms:1.4.3.13 | LOXL2 | Lysyl oxidase homolog 2 | Lysyl oxidase-like protein 2 | Lysyl oxidase-related protein 2 | Lysyl oxidase-related protein WS9-14
Type:PROTEIN
Mol. Mass.:86721.38
Organism:Homo sapiens (Human)
Description:ChEMBL_115990
Residue:774
Sequence:
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: