| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orexin receptor type 2 |
|---|
| Ligand | BDBM203419 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1650583 (CHEMBL3999717) |
|---|
| Ki | 1.7±n/a nM |
|---|
| Citation |  Skudlarek, JW; DiMarco, CN; Babaoglu, K; Roecker, AJ; Bruno, JG; Pausch, MA; O'Brien, JA; Cabalu, TD; Stevens, J; Brunner, J; Tannenbaum, PL; Wuelfing, WP; Garson, SL; Fox, SV; Savitz, AT; Harrell, CM; Gotter, AL; Winrow, CJ; Renger, JJ; Kuduk, SD; Coleman, PJ Investigation of orexin-2 selective receptor antagonists: Structural modifications resulting in dual orexin receptor antagonists. Bioorg Med Chem Lett27:1364-1370 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orexin receptor type 2 |
|---|
| Name: | Orexin receptor type 2 |
|---|
| Synonyms: | HCRTR2 | Hypocretin receptor type 2 | OX2R_HUMAN | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 50710.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O43614 |
|---|
| Residue: | 444 |
|---|
| Sequence: | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
|
|
|
|---|
| BDBM203419 |
|---|
| n/a |
|---|
| Name | BDBM203419 |
|---|
| Synonyms: | 2-({(3r,6r)-1-[(2-cyclopropyl- 6-methoxypyridin-3- yl)carbonyl]-6- methylpiperidin-3-yl}oxy)-3- methylpyridine-4-carbonitrile | US9546152, example 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26N4O3 |
|---|
| Mol. Mass. | 406.4775 |
|---|
| SMILES | COc1ccc(C(=O)N2C[C@@H](CC[C@H]2C)Oc2nccc(C#N)c2C)c(n1)C1CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
