Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50233522
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1650965
Ki 7±n/a nM
Citation Sandham DABarker LBrown LBrown ZBudd DCharlton SJChatterjee DCox BDubois GDuggan NHall EHatto JMaas JManini JProfit RRiddy DRitchie CSohal BShaw DStringer RSykes DAThomas MTurner KLWatson SJWest RWillard EWilliams GWillis J Discovery of Fevipiprant (NVP-QAW039), a Potent and Selective DP ACS Med Chem Lett 8:582-586 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50233522
n/a
NameBDBM50233522
Synonyms:CHEMBL3932668
TypeSmall organic molecule
Emp. Form.C20H19F3N2O4S
Mol. Mass.440.436
SMILESCCS(=O)(=O)c1ccc(Cn2c(C)c(CC(O)=O)c3cccnc23)c(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: