Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50233626
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1651027
Ki 2.7±n/a nM
Citation Szabo MLim HDHerenbrink CKChristopoulos ALane JRCapuano B Proof of concept study for designed multiple ligands targeting the dopamine D2, serotonin 5-HT2A, and muscarinic M1 acetylcholine receptors. J Med Chem 58:1550-5 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50233626
n/a
NameBDBM50233626
Synonyms:CHEMBL4062602
TypeSmall organic molecule
Emp. Form.C23H24FN3O3
Mol. Mass.409.4534
SMILESFc1ccc2c(noc2c1)C1CCN(CCCN2C(=O)COc3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: