Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM181119
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1651917
Ki 490±n/a nM
Citation Odell LRAbdel-Hamid MKHill TAChau NYoung KADeane FMSakoff JAAndersson SDaniel JARobinson PJMcCluskey A Pyrimidine-Based Inhibitors of Dynamin I GTPase Activity: Competitive Inhibition at the Pleckstrin Homology Domain. J Med Chem 60:349-361 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM181119
n/a
NameBDBM181119
Synonyms:US9138393, Cimetidine | US9144538, Cimetidine
TypeSmall organic molecule
Emp. Form.C10H16N6S
Mol. Mass.252.339
SMILESCN\C(NC#N)=N\CCSCc1nc[nH]c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: