Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50234003 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1651957 (CHEMBL4001212) |
---|
IC50 | 4290±n/a nM |
---|
Citation | Li, K; Li, L; Wang, S; Li, X; Ma, T; Liu, D; Jing, Y; Zhao, L Design and synthesis of novel 2-substituted 11-keto-boswellic acid heterocyclic derivatives as anti-prostate cancer agents with Pin1 inhibition ability. Eur J Med Chem126:910-919 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50234003 |
---|
n/a |
---|
Name | BDBM50234003 |
Synonyms: | CHEMBL4085308 |
Type | Small organic molecule |
Emp. Form. | C34H49IN2O3 |
Mol. Mass. | 660.6689 |
SMILES | [H][C@@]12CC[C@]3(C)[C@]([H])(C(=O)C=C4[C@]5([H])[C@@H](C)[C@H](C)CC[C@]5(C)CC[C@@]34C)[C@@]1(C)C=C(I)C(=O)[C@]2(C)C(=O)N1CCNCC1 |r,t:10,32| |
Structure |
|