Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHeat shock factor protein 1
LigandBDBM50428286
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1652055
IC50<10000±n/a nM
Citation Cheeseman MDChessum NERye CSPasqua AETucker MJWilding BEvans LELepri SRichards MSharp SYAli SRowlands MO'Fee LMiah AHayes AHenley ATPowers MTe Poele RDe Billy EPellegrino LRaynaud FBurke Rvan Montfort RLEccles SAWorkman PJones K Discovery of a Chemical Probe Bisamide (CCT251236): An Orally Bioavailable Efficacious Pirin Ligand from a Heat Shock Transcription Factor 1 (HSF1) Phenotypic Screen. J Med Chem 60:180-201 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Heat shock factor protein 1
Name:Heat shock factor protein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:57244.20
Organism:Homo sapiens (Human)
Description:ChEMBL_1512556
Residue:529
Sequence:
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428286
n/a
NameBDBM50428286
Synonyms:DABRAFENIB | GSK2118436A
TypeSmall organic molecule
Emp. Form.C23H20F3N5O2S2
Mol. Mass.519.562
SMILESCC(C)(C)c1nc(c(s1)-c1ccnc(N)n1)-c1cccc(NS(=O)(=O)c2c(F)cccc2F)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: