Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-regulated kinases 1B
LigandBDBM50234807
Substrate/Competitorn/a
Meas. Tech.ChEBML_1654011
IC50 37±n/a nM
Citation Murár MDobia? J?ramel PAddová GHanquet GBohác A Novel CLK1 inhibitors based on N-aryloxazol-2-amine skeleton - A possible way to dual VEGFR2 TK/CLK ligands. Eur J Med Chem 126:754-761 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-regulated kinases 1B
Name:Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms:DYRK1B | Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Type:Enzyme
Mol. Mass.:69222.24
Organism:Homo sapiens (Human)
Description:Q9Y463
Residue:629
Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234807
n/a
NameBDBM50234807
Synonyms:CHEMBL1738733
TypeSmall organic molecule
Emp. Form.C17H13N3O3
Mol. Mass.307.3034
SMILESO=C1N=C(Nc2ccccc2)N=C1Cc1ccc2OCOc2c1 |c:12,t:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: