Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK2
LigandBDBM50355501
Substrate/Competitorn/a
Meas. Tech.ChEBML_1653997
Kd 460±n/a nM
Citation Murár MDobia? J?ramel PAddová GHanquet GBohác A Novel CLK1 inhibitors based on N-aryloxazol-2-amine skeleton - A possible way to dual VEGFR2 TK/CLK ligands. Eur J Med Chem 126:754-761 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK2
Name:Dual specificity protein kinase CLK2
Synonyms:CDC-like kinase 2 | CDC-like kinase 2 (CLK2) | CDC2-like kinase 2 (CLK2)
Type:Protein
Mol. Mass.:60128.79
Organism:Homo sapiens (Human)
Description:P49760
Residue:499
Sequence:
MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQC
VDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMC
ISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQ
PCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFA
RLRAEPPNKLWDSSRDISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355501
n/a
NameBDBM50355501
Synonyms:INCB-018424 | RUXOLITINIB | RUXOLITINIB PHOSPHATE | US10112907, Example 00016
TypeSmall organic molecule
Emp. Form.C17H18N6
Mol. Mass.306.365
SMILESN#CC[C@H](C1CCCC1)n1cc(cn1)-c1ncnc2[nH]ccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: