| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM50235196 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1654962 (CHEMBL4004328) |
|---|
| IC50 | 40±n/a nM |
|---|
| Citation |  Chobanian, HR; Guo, Y; Pio, B; Tang, H; Teumelsan, N; Clements, M; Frie, J; Ferguson, R; Guo, Z; Thomas-Fowlkes, BS; Felix, JP; Liu, J; Kohler, M; Priest, B; Hampton, C; Pai, LY; Corona, A; Metzger, J; Tong, V; Joshi, EM; Xu, L; Owens, K; Maloney, K; Sullivan, K; Pasternak, A The design and synthesis of novel spirocyclic heterocyclic sulfone ROMK inhibitors as diuretics. Bioorg Med Chem Lett27:1109-1114 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44976.27 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P35560 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
|---|
| BDBM50235196 |
|---|
| n/a |
|---|
| Name | BDBM50235196 |
|---|
| Synonyms: | CHEMBL4064760 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N4O5S |
|---|
| Mol. Mass. | 486.584 |
|---|
| SMILES | Cc1c2COC(=O)c2ccc1[C@@H](O)CN1CCC2(CCN(C2)c2cnc(cn2)S(C)(=O)=O)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
