| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K epoxide reductase complex subunit 1 |
|---|
| Ligand | BDBM50235661 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1657647 (CHEMBL4007117) |
|---|
| Ki | 20±n/a nM |
|---|
| Citation |  Montagut-Romans, A; Boulven, M; Jacolot, M; Moebs-Sanchez, S; Hascoët, C; Hammed, A; Besse, S; Lemaire, M; Benoit, E; Lattard, V; Popowycz, F Synthesis and biological evaluation of C-3 aliphatic coumarins as vitamin K antagonists. Bioorg Med Chem Lett27:1598-1601 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K epoxide reductase complex subunit 1 |
|---|
| Name: | Vitamin K epoxide reductase complex subunit 1 |
|---|
| Synonyms: | VKOR1_RAT | Vitamin K epoxide reductase complex subunit 1 (rVKORC1) | Vkorc1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17793.51 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q6TEK4 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYL
AWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP
|
|
|
|---|
| BDBM50235661 |
|---|
| n/a |
|---|
| Name | BDBM50235661 |
|---|
| Synonyms: | CHEMBL4088796 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H44O3 |
|---|
| Mol. Mass. | 440.6579 |
|---|
| SMILES | CC(C)CCCC(C)CCCC(C)CCC\C(C)=C\Cc1c(O)c2ccccc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
