Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEZH2/SUZ12/EED/RBBP7/RBBP4
LigandBDBM172038
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658554
IC50 2±n/a nM
Citation Huang YZhang JYu ZZhang HWang YLingel AQi WGu JZhao KShultz MDWang LFu XSun YZhang QJiang XZhang JZhang CLi LZeng JFeng LZhang CLiu YZhang MZhang LZhao MGao ZLiu XFang DGuo HMi YGabriel TDillon MPAtadja POyang C Discovery of First-in-Class, Potent, and Orally Bioavailable Embryonic Ectoderm Development (EED) Inhibitor with Robust Anticancer Efficacy. J Med Chem 60:2215-2226 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EZH2/SUZ12/EED/RBBP7/RBBP4
Name:EZH2/SUZ12/EED/RBBP7/RBBP4
Synonyms:EED | Polycomb protein EED | WAIT-1 | WD protein associating with integrin cytoplasmic tails 1 | hEED
Type:Protein
Mol. Mass.:50201.68
Organism:Homo sapiens (Human)
Description:O75530
Residue:441
Sequence:
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM172038
n/a
NameBDBM172038
Synonyms:US10155002, Compound 44 | US9090562, 143 | US9090562, 44 | US9394283, 1
TypeSmall organic molecule
Emp. Form.C34H44N4O4
Mol. Mass.572.7376
SMILESCCN(C1CCOCC1)c1cc(cc(C(=O)NCc2c(C)cc(C)[nH]c2=O)c1C)-c1ccc(CN2CCOCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: