| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM50236211 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1658825 (CHEMBL4008437) |
|---|
| IC50 | >30000±n/a nM |
|---|
| Citation |  Vulpetti, A; Randl, S; Rüdisser, S; Ostermann, N; Erbel, P; Mac Sweeney, A; Zoller, T; Salem, B; Gerhartz, B; Cumin, F; Hommel, U; Dalvit, C; Lorthiois, E; Maibaum, J Structure-Based Library Design and Fragment Screening for the Identification of Reversible Complement Factor D Protease Inhibitors. J Med Chem60:1946-1958 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM50236211 |
|---|
| n/a |
|---|
| Name | BDBM50236211 |
|---|
| Synonyms: | CHEMBL4065974 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20F3N3O5 |
|---|
| Mol. Mass. | 451.3958 |
|---|
| SMILES | COC(=O)c1cccc(NC(=O)N2CCC[C@H]2C(=O)Nc2cccc(OC(F)(F)F)c2)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
