Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor D
LigandBDBM50236214
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658835
Kd 500000±n/a nM
Citation Vulpetti ARandl SRüdisser SOstermann NErbel PMac Sweeney AZoller TSalem BGerhartz BCumin FHommel UDalvit CLorthiois EMaibaum J Structure-Based Library Design and Fragment Screening for the Identification of Reversible Complement Factor D Protease Inhibitors. J Med Chem 60:1946-1958 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Factor D
Name:Complement factor D
Synonyms:Adipsin | C3 convertase activator | CFD | Complement Factor D | DF | PFD | Properdin factor D
Type:Protein
Mol. Mass.:27039.19
Organism:Homo sapiens (Human)
Description:P00746
Residue:253
Sequence:
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236214
n/a
NameBDBM50236214
Synonyms:CHEMBL4089211
TypeSmall organic molecule
Emp. Form.C19H15FN2O3
Mol. Mass.338.3324
SMILESOC(=O)c1[nH]c2ccc(F)cc2c1NC(=O)C1CC1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: