Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyruvate dehydrogenase kinase isoenzyme 1 (PDK1)
LigandBDBM50236525
Substrate/Competitorn/a
Meas. Tech.ChEBML_1659261
Ki 260±n/a nM
Citation Brough PABaker LBedford SBrown KChavda SChell VD'Alessandro JDavies NGDavis BLe Strat LMacias ATMaddox DMahon PCMassey AJMatassova NMcKenna SMeissner JWMoore JDMurray JBNorthfield CJParry CParsons RRoughley SDShaw TSimmonite HStokes SSurgenor AStefaniak ERobertson AWang YWebb PWhitehead NWood M Application of Off-Rate Screening in the Identification of Novel Pan-Isoform Inhibitors of Pyruvate Dehydrogenase Kinase. J Med Chem 60:2271-2286 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1)
Name:Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform/[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
Synonyms:Pyruvate dehydrogenase kinase | Pyruvate dehydrogenase kinase 1 (PDK1) | Pyruvate dehydrogenase kinase isoform 1
Type:Protein
Mol. Mass.:49255.23
Organism:Homo sapiens (Human)
Description:Q15118
Residue:436
Sequence:
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP
ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236525
n/a
NameBDBM50236525
Synonyms:CHEMBL4097485
TypeSmall organic molecule
Emp. Form.C24H20N2O7
Mol. Mass.448.4248
SMILESCN(C(=O)c1ccc(O)cc1O)c1ccc(cc1)C(=O)N1CC(Oc2ccccc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: