Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyruvate dehydrogenase kinase
LigandBDBM50236526
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1659252
Ki 150±n/a nM
Citation Brough PABaker LBedford SBrown KChavda SChell VD'Alessandro JDavies NGDavis BLe Strat LMacias ATMaddox DMahon PCMassey AJMatassova NMcKenna SMeissner JWMoore JDMurray JBNorthfield CJParry CParsons RRoughley SDShaw TSimmonite HStokes SSurgenor AStefaniak ERobertson AWang YWebb PWhitehead NWood M Application of Off-Rate Screening in the Identification of Novel Pan-Isoform Inhibitors of Pyruvate Dehydrogenase Kinase. J Med Chem 60:2271-2286 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyruvate dehydrogenase kinase
Name:Pyruvate dehydrogenase kinase
Synonyms:Pyruvate dehydrogenase kinase 2 (PDK2) | Pyruvate dehydrogenase kinase isoenzyme 1 (PDK2)
Type:Enzyme
Mol. Mass.:46153.78
Organism:Homo sapiens (Human)
Description:Q15119
Residue:407
Sequence:
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236526
n/a
NameBDBM50236526
Synonyms:CHEMBL4089806
TypeSmall organic molecule
Emp. Form.C17H18N2O4
Mol. Mass.314.3358
SMILESCN(C)C(=O)c1ccc(cc1)N(C)C(=O)c1ccc(O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: