Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyruvate dehydrogenase kinase 4 (PDK4)
LigandBDBM50236522
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1659257
Ki 1270±n/a nM
Citation Brough PABaker LBedford SBrown KChavda SChell VD'Alessandro JDavies NGDavis BLe Strat LMacias ATMaddox DMahon PCMassey AJMatassova NMcKenna SMeissner JWMoore JDMurray JBNorthfield CJParry CParsons RRoughley SDShaw TSimmonite HStokes SSurgenor AStefaniak ERobertson AWang YWebb PWhitehead NWood M Application of Off-Rate Screening in the Identification of Novel Pan-Isoform Inhibitors of Pyruvate Dehydrogenase Kinase. J Med Chem 60:2271-2286 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyruvate dehydrogenase kinase 4 (PDK4)
Name:Pyruvate dehydrogenase kinase
Synonyms:Pyruvate dehydrogenase kinase | Pyruvate dehydrogenase kinase isoform 4
Type:Enzyme
Mol. Mass.:46469.71
Organism:Homo sapiens (Human)
Description:Q16654
Residue:411
Sequence:
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236522
n/a
NameBDBM50236522
Synonyms:CHEMBL4061698
TypeSmall organic molecule
Emp. Form.C15H15NO4
Mol. Mass.273.2839
SMILESCOc1ccc(cc1)N(C)C(=O)c1ccc(O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: