Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 3
LigandBDBM100152
Substrate/Competitorn/a
Meas. Tech.ChEBML_1659328
IC50 410±n/a nM
Citation Zhou QPhoa AFAbbassi RHHoque MReekie TAFont JSRyan RMStringer BWDay BWJohns TGMunoz LKassiou M Structural Optimization and Pharmacological Evaluation of Inhibitors Targeting Dual-Specificity Tyrosine Phosphorylation-Regulated Kinases (DYRK) and CDC-like kinases (CLK) in Glioblastoma. J Med Chem 60:2052-2070 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 3
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:65747.26
Organism:Homo sapiens (Human)
Description:ChEMBL_1508026
Residue:588
Sequence:
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPR
RLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM100152
n/a
NameBDBM100152
Synonyms:7-methoxy-1-methyl-9H-beta-carboline;hydrochloride | 7-methoxy-1-methyl-9H-pyrido[3,4-b]indole;hydrochloride | HARMINE | Harmine hydrochloride | MLS002153910 | SMR001233259 | cid_5359389
TypeSmall organic molecule
Emp. Form.C13H12N2O
Mol. Mass.212.2472
SMILESCOc1ccc2c(c1)[nH]c1c(C)nccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: