Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B
LigandBDBM50236536
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1659284
IC50 172±n/a nM
Citation Zhou QPhoa AFAbbassi RHHoque MReekie TAFont JSRyan RMStringer BWDay BWJohns TGMunoz LKassiou M Structural Optimization and Pharmacological Evaluation of Inhibitors Targeting Dual-Specificity Tyrosine Phosphorylation-Regulated Kinases (DYRK) and CDC-like kinases (CLK) in Glioblastoma. J Med Chem 60:2052-2070 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Name:Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms:DYRK1B | Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Type:Enzyme
Mol. Mass.:69222.24
Organism:Homo sapiens (Human)
Description:Q9Y463
Residue:629
Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236536
n/a
NameBDBM50236536
Synonyms:CHEMBL4102553
TypeSmall organic molecule
Emp. Form.C20H14N6O
Mol. Mass.354.3648
SMILESOc1ccc(cc1)-c1cnc2[nH]cc(-c3ccc(cc3)-c3nnn[nH]3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: