Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetZinc finger protein 664
LigandBDBM21398
Substrate/Competitorn/a
Meas. Tech.ChEBML_1659535
Ki 6.6±n/a nM
Citation Soeberdt MMolenveld PStorcken RPBouzanne des Mazery RSterk GJAutar RBolster MGWagner CAerts SNvan Holst FRWegert ATangherlini GFrehland BSchepmann DMetze DLotts TKnie ULin KYHuang TYLai CCStänder SWünsch BAbels C Design and Synthesis of Enantiomerically Pure Decahydroquinoxalines as Potent and Selective¿-Opioid Receptor Agonists with Anti-Inflammatory Activity in Vivo. J Med Chem 60:2526-2551 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Zinc finger protein 664
Name:Zinc finger protein 664
Synonyms:ZFOC1 | ZNF664 | Zinc finger protein 664 | Zinc finger protein from organ of Corti
Type:PROTEIN
Mol. Mass.:30308.74
Organism:Cavia porcellus
Description:ChEMBL_117362
Residue:261
Sequence:
MIYKCPMCREFFSERADLFMHQKVHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYK
CDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSPHLQIHMRVHTGEKPYVCSEC
GRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAF
SQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQST
SLCIHQRVHTKERNHLKISVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21398
n/a
NameBDBM21398
Synonyms:4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1
TypeSmall organic molecule
Emp. Form.C21H23ClFNO2
Mol. Mass.375.864
SMILESOC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: