Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase 1A1 (ALDH1A1)
LigandBDBM50078833
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1659748
Ki 870±n/a nM
Citation Buchman CDHurley TD Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives. J Med Chem 60:2439-2455 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase 1A1 (ALDH1A1)
Name:Aldehyde dehydrogenase 1A1 (ALDH1A1)
Synonyms:ALDH-E1 | ALHDII | Aldehyde dehydrogenase family 1 member A1 | Aldehyde dehydrogenase family 1 member A1 (ALDH1A1) | Aldehyde dehydrogenase, cytosolic | RALDH 1 | RalDH1 | Retinal dehydrogenase 1
Type:Protein
Mol. Mass.:54862.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:501
Sequence:
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078833
n/a
NameBDBM50078833
Synonyms:4-Methyl-7-(diethylamino)coumarin | 7-(diethylamino)-4-methyl-2H-chromen-2-one | CHEMBL315348 | Coumarin 1 | Coumarin 47 | coumarin 460
TypeSmall organic molecule
Emp. Form.C14H17NO2
Mol. Mass.231.2903
SMILESCCN(CC)c1ccc2c(C)cc(=O)oc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: